PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10000273m
Common NameEUTSA_v10000273mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family BBR-BPC
Protein Properties Length: 292aa    MW: 32570.8 Da    PI: 9.7325
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10000273mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind312.21.8e-951829115301
        GAGA_bind  15 e.................paaslkenlglqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernkalverdnkllalllvensl 91 
                      +                 ++++l   +++++ms++aerda+++ern+a+s+k++ava+rd+a++qrdkal+er+kal+erd +++al+++ensl
  Thhalv10000273m  18 KgaqstmwnmmpqhqikeQHNALV--MNKKIMSILAERDAAVQERNQAVSAKREAVAARDEALQQRDKALSERDKALIERDTAFAALQHHENSL 109
                      355555555555554543456666..99****************************************************************97 PP

        GAGA_bind  92 asalpvgvqvlsgtksidslqqlsepqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskkkvkkesade 185
                      ++al       sg k+    +        d+ +   e++k +++pi++ + e+k +k+          k++ + k kk +e+ ++ v++++  +
  Thhalv10000273m 110 NFAL-------SGGKQRY--DV-------DDGFSFGETHKPDVFPITTIPAEKKVSKR----------KKQGQAKGKKVGEDLNRGVAAPG--K 175
                      6655.......5555433..33.......557778899999****9996655443333..........334455666778889999*****..5 PP

        GAGA_bind 186 rskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydl 279
                      +s+++++s d++ln v++De+t+PvPvC+CtG+ +qCYkWGnGGWqS+CCttt+S+yPLP+++++r++R++grKmS+++f++lL++LaaeGy+l
  Thhalv10000273m 176 KSRTDWDSNDVGLNLVTFDETTMPVPVCTCTGSAHQCYKWGNGGWQSSCCTTTLSQYPLPQMPNKRHSRVGGRKMSGNVFSRLLSRLAAEGYEL 269
                      7********************************************************************************************* PP

        GAGA_bind 280 snpvDLkdhWAkHGtnkfvtir 301
                      s+pvDLkd+WA+HGtn+++ti+
  Thhalv10000273m 270 SCPVDLKDYWARHGTNRYITIK 291
                      *********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012263.1E-1521291IPR010409GAGA-binding transcriptional activator
PfamPF062171.8E-9213291IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0050793Biological Processregulation of developmental process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MENGGQYENG RYKPDHLKGA QSTMWNMMPQ HQIKEQHNAL VMNKKIMSIL AERDAAVQER  60
NQAVSAKREA VAARDEALQQ RDKALSERDK ALIERDTAFA ALQHHENSLN FALSGGKQRY  120
DVDDGFSFGE THKPDVFPIT TIPAEKKVSK RKKQGQAKGK KVGEDLNRGV AAPGKKSRTD  180
WDSNDVGLNL VTFDETTMPV PVCTCTGSAH QCYKWGNGGW QSSCCTTTLS QYPLPQMPNK  240
RHSRVGGRKM SGNVFSRLLS RLAAEGYELS CPVDLKDYWA RHGTNRYITI K*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0071421e-126AC007142.7 Arabidopsis thaliana chromosome 2 clone F7O24 map mi238, complete sequence.
GenBankCP0026851e-126CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006404565.10.0hypothetical protein EUTSA_v10000273mg
SwissprotQ8S8C60.0BPC4_ARATH; Protein BASIC PENTACYSTEINE4
TrEMBLV4M1G30.0V4M1G3_EUTSA; Uncharacterized protein
STRINGfgenesh2_kg.4__42__AT2G21240.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM40902659
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G21240.20.0basic pentacysteine 4